PDB entry 2aqm

View 2aqm on RCSB PDB site
Description: CU/ZN superoxide dismutase from brucella abortus
Class: oxidoreductase
Keywords: superoxide dismutase, brucella abortus, OXIDOREDUCTASE
Deposited on 2005-08-18, released 2006-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.114
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Superoxide dismutase [Cu-Zn]
  Species: Brucella abortus [TaxId:235]
  Gene: SODC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15453 (0-153)
  Domains in SCOPe 2.06: d2aqma_
• Heterogens: CU1, ZN, SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aqmA (A:)
  esttvkmyealptgpgkevgtvviseapgglhfkvnmekltpgyhgfhvhenpscapgek
  dgkivpalaagghydpgnthhhlgpegdghmgdlprlsanadgkvsetvvaphlkklaei
  kqrslmvhvggdnysdkpeplggggarfacgvie