PDB entry 2aqf

View 2aqf on RCSB PDB site
Description: Structural and functional analysis of ADA2 alpha swirm domain
Class: transcription
Keywords: helix-turn-helix
Deposited on 2005-08-17, released 2006-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-05, with a file datestamp of 2007-07-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional adaptor 2, Ada2 alpha
    Species: MUS MUSCULUS
    Gene: Tada21
    Database cross-references and differences (RAF-indexed):
    • GB NP_766150 (1-89)
      • cloning artifact (0)
    Domains in SCOP 1.75: d2aqfa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aqfA (A:)
    gsnsgrrsapplnltglpgteklnekekelcqvvrlvpgayleyksallnechkqgglrl
    aqaralikidvnktrkiydfliregyitka