PDB entry 2aqf

View 2aqf on RCSB PDB site
Description: Structural and functional analysis of ADA2 alpha swirm domain
Class: transcription
Keywords: helix-turn-helix, TRANSCRIPTION
Deposited on 2005-08-17, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional adaptor 2, Ada2 alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Tada21
    Database cross-references and differences (RAF-indexed):
    • GB NP_766150 (1-89)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d2aqfa2, d2aqfa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aqfA (A:)
    gsnsgrrsapplnltglpgteklnekekelcqvvrlvpgayleyksallnechkqgglrl
    aqaralikidvnktrkiydfliregyitka