PDB entry 2aqe

View 2aqe on RCSB PDB site
Description: Structural and functional analysis of ada2 alpha swirm domain
Class: transcription
Keywords: helix-turn-helix
Deposited on 2005-08-17, released 2005-12-13
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-13, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcriptional adaptor 2, Ada2 alpha
  Species: MUS MUSCULUS
  Gene: Tada21
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8BNK0 (1-89)
    • cloning artifact (0)
  Domains in SCOP 1.73: d2aqea1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aqeA (A:)
  gsnsgrrsapplnltglpgteklnekekelcqvvrlvpgayleyksallnechkqgglrl
  aqaralikidvnktrkiydfliregyitka