PDB entry 2aq2

View 2aq2 on RCSB PDB site
Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3 mutant
Class: Immune system
Keywords: T-cell receptor v beta domain, staphlococcal enterotoxin c3, complex structure
Deposited on 2005-08-17, released 2006-03-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-21, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell receptor beta chain V
    Species: MUS MUSCULUS
  • Chain 'B':
    Compound: Enterotoxin type C-3
    Species: STAPHYLOCOCCUS AUREUS
    Gene: entC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5
      • see remark 999 (101-103)
    Domains in SCOP 1.73: d2aq2b1, d2aq2b2
  • Heterogens: ZN, NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aq2B (B:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwpgktcmyggitkhegnh
    fdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspye
    tgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aq2B (B:)
    sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
    dkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwpgktcmyggitkhegnhf
    dngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyet
    gyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk