PDB entry 2aq1

View 2aq1 on RCSB PDB site
Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3 mutant
Class: Immune System
Keywords: T-cell receptor, staphylococcal enterotoxin c3, superantigen, complex (toxin/receptor)
Deposited on 2005-08-17, released 2006-03-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-21, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell receptor beta chain V
    Species: MUS MUSCULUS
  • Chain 'B':
    Compound: Enterotoxin type C-3
    Species: STAPHYLOCOCCUS AUREUS
    Gene: entC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5
      • see remark 999 (101-103)
    Domains in SCOP 1.73: d2aq1b1, d2aq1b2
  • Chain 'C':
    Compound: T-cell receptor beta chain V
    Species: MUS MUSCULUS
  • Chain 'D':
    Compound: Enterotoxin type C-3
    Species: STAPHYLOCOCCUS AUREUS
    Gene: entC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5 (Start-236)
      • see remark 999 (101-103)
    Domains in SCOP 1.73: d2aq1d1, d2aq1d2
  • Chain 'E':
    Compound: T-cell receptor beta chain V
    Species: MUS MUSCULUS
  • Chain 'F':
    Compound: Enterotoxin type C-3
    Species: STAPHYLOCOCCUS AUREUS
    Gene: entC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5 (0-236)
      • see remark 999 (101-103)
    Domains in SCOP 1.73: d2aq1f1, d2aq1f2
  • Chain 'G':
    Compound: T-cell receptor beta chain V
    Species: MUS MUSCULUS
  • Chain 'H':
    Compound: Enterotoxin type C-3
    Species: STAPHYLOCOCCUS AUREUS
    Gene: entC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5 (0-236)
      • see remark 999 (101-103)
    Domains in SCOP 1.73: d2aq1h1, d2aq1h2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aq1B (B:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwhgktcmyggitkhegnh
    fdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspye
    tgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aq1B (B:)
    sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
    dkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwhgktcmyggitkhegnhf
    dngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyet
    gyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2aq1D (D:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwhgktcmyggitkhegnh
    fdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspye
    tgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aq1D (D:)
    sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
    dkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwhgktcmyggitkhegnhf
    dngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyet
    gyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aq1F (F:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwhgktcmyggitkhegnh
    fdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspye
    tgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aq1H (H:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwhgktcmyggitkhegnh
    fdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspye
    tgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng