PDB entry 2apx
View 2apx on RCSB PDB site
Description: Crystal Structure of the G17E/A52V/S54N/K66E/Q72H/E80V/L81S/T87S/G96V variant of the murine T cell receptor V beta 8.2 domain
Class: immune system
Keywords: the murine T cell receptor V beta 8.2 domain, Immune system
Deposited on
2005-08-16, released
2006-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-04-04, with a file datestamp of
2018-03-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: T cell receptor beta chain V
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2apxa_ - Heterogens: MLA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2apxA (A:)
ileaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekg
dipdgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
Sequence, based on observed residues (ATOM records): (download)
>2apxA (A:)
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl