PDB entry 2aps

View 2aps on RCSB PDB site
Description: cu/zn superoxide dismutase from actinobacillus pleuropneumoniae
Class: superoxide dismutase
Keywords: superoxide dismutase, sod, water-mediated dimer, beta barrel
Deposited on 1999-02-11, released 1999-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.221
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cu,zn superoxide dismutase)
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Gene: SODC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24702 (7-161)
    • GB X99396 (7-161)
    Domains in SCOPe 2.07: d2apsa_
  • Chain 'B':
    Compound: protein (cu,zn superoxide dismutase)
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Gene: SODC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24702 (7-161)
    • GB X99396 (7-161)
    Domains in SCOPe 2.07: d2apsb_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2apsA (A:)
    kadnssveklvvqvqqldpvkgnkdvgtveitesayglvftphlhglaqglhgfhihqnp
    scepkekdgklvaglgagghwdpketkqhgypwsdnahlgdlpalfvehdgsatnpvlap
    rlkkldevkghslmiheggdnhsdhpaplggggprmacgvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2apsA (A:)
    eklvvqvqqldpvkgnkdvgtveitesayglvftphlhglaqglhgfhihqnpscepkek
    dgklvaglgagghwdpketkqhgypwsdnahlgdlpalfvehdgsatnpvlaprlkklde
    vkghslmiheggdnhsdhpaplggggprmacgvik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2apsB (B:)
    kadnssveklvvqvqqldpvkgnkdvgtveitesayglvftphlhglaqglhgfhihqnp
    scepkekdgklvaglgagghwdpketkqhgypwsdnahlgdlpalfvehdgsatnpvlap
    rlkkldevkghslmiheggdnhsdhpaplggggprmacgvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2apsB (B:)
    eklvvqvqqldpvkgnkdvgtveitesayglvftphlhglaqglhgfhihqnpscepkek
    dgklvaglgagghwdpketkqhgypwsdnahlgdlpalfvehdgsatnpvlaprlkklde
    vkghslmiheggdnhsdhpaplggggprmacgvik