PDB entry 2ap2

View 2ap2 on RCSB PDB site
Description: single chain fv of c219 in complex with synthetic epitope peptide
Class: immune system
Keywords: single chain fv, monoclonal antibody, c219, p-glycoprotein, immunoglobulin, immune system
Deposited on 1999-03-22, released 1999-11-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (antibody (light chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB M34744 (3-114)
      • see remark 999 (0-2)
      • conflict (114)
    Domains in SCOPe 2.02: d2ap2a_
  • Chain 'B':
    Compound: protein (antibody (heavy chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AP2 (0-121)
    Domains in SCOPe 2.02: d2ap2b_
  • Chain 'C':
    Compound: protein (antibody (light chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB M34744 (3-114)
      • see remark 999 (0-2)
      • conflict (114)
    Domains in SCOPe 2.02: d2ap2c_
  • Chain 'D':
    Compound: protein (antibody (heavy chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AP2 (0-121)
    Domains in SCOPe 2.02: d2ap2d_
  • Chain 'E':
    Compound: protein (c-myc tag and his tag)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2AP2 (6-End)
  • Chain 'F':
    Compound: protein (c-myc tag and his tag)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2AP2 (0-End)
  • Chain 'P':
    Compound: protein (p-glycoprotein)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB M17897 (0-End)
  • Chain 'Q':
    Compound: protein (p-glycoprotein)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB M17897 (0-13)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ap2A (A:)
fvrdivmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywa
stresgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklep

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ap2B (B:)
evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
apkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvp
sg

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ap2C (C:)
fvrdivmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywa
stresgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklep

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ap2D (D:)
evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
apkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvp
sg

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.