PDB entry 2aoz

View 2aoz on RCSB PDB site
Description: Crystal structure of the myotoxin-II from Atropoides nummifer venom
Class: toxin
Keywords: X-ray diffration, myotoxicity, phospholipase A2, Atropoides nummifer, TOXIN
Deposited on 2005-08-15, released 2006-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.221
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 homolog
  Species: Atropoides nummifer [TaxId:44730]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P82950 (0-120)
  Domains in SCOPe 2.08: d2aoza_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aozA (A:)
  nlyqlwkmilqetgknaapsygfygcncgvgsrgkpkdatdrccfvhkccykaltdcspk
  tdsysyswkdktivcgknnpclkqececdkavaiclrdnldtynknykiypkplckkadd
  c