PDB entry 2aog
View 2aog on RCSB PDB site
Description: Crystal structure analysis of HIV-1 protease mutant V82A with a substrate analog P2-NC
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, mutant, dimer, substrate analog, hydrolase-hydrolase inhibitor complex
Deposited on
2005-08-12, released
2006-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-11, with a file datestamp of
2017-10-06.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease (retropepsin)
Species: Human immunodeficiency virus 1 [TaxId:11682]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587
- engineered (6)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (81)
- engineered (94)
Domains in SCOPe 2.08: d2aoga_ - Chain 'B':
Compound: hiv-1 protease (retropepsin)
Species: Human immunodeficiency virus 1 [TaxId:11682]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- engineered (6)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (81)
- engineered (94)
Domains in SCOPe 2.08: d2aogb_ - Heterogens: 2NC, UNX, GOL, ACY, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2aogA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2aogB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf