PDB entry 2aog

View 2aog on RCSB PDB site
Description: Crystal structure analysis of HIV-1 protease mutant V82A with a substrate analog P2-NC
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, mutant, dimer, substrate analog, hydrolase-hydrolase inhibitor complex
Deposited on 2005-08-12, released 2006-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease (retropepsin)
  Species: Human immunodeficiency virus 1 [TaxId:11682]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (81)
    • engineered (94)
  Domains in SCOPe 2.08: d2aoga_
• Chain 'B':
  Compound: hiv-1 protease (retropepsin)
  Species: Human immunodeficiency virus 1 [TaxId:11682]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (81)
    • engineered (94)
  Domains in SCOPe 2.08: d2aogb_
• Heterogens: 2NC, UNX, GOL, ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aogA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aogB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf