PDB entry 2ao8

View 2ao8 on RCSB PDB site
Description: Binding of chitin-like polysaccharide to protective signalling factor: Crystal structure of the complex formed between signalling protein from sheep (SPS-40) with a tetrasaccharide at 2.2 A resolution
Class: signaling protein
Keywords: signalling protein, complex, tetrasaccharide, crystal structure, sps-40
Deposited on 2005-08-12, released 2005-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2006-07-25, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal Processing Protein, SPS-40
    Species: Ovis aries
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAQ94054 (0-360)
    Domains in SCOPe 2.07: d2ao8a1, d2ao8a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ao8A (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptfg
    rsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae
    v