PDB entry 2anp

View 2anp on RCSB PDB site
Description: Functional Glutamate 151 to Histidine mutant of the aminopeptidase from Aeromonas Proteolytica.
Class: hydrolase
Keywords: aminopeptidase, bi-metallic, zinc, crystallography, EPR, spectroscopy, HYDROLASE
Deposited on 2005-08-11, released 2005-10-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucyl aminopeptidase
    Species: Vibrio proteolyticus [TaxId:671]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01693 (0-290)
      • engineered (150)
    Domains in SCOPe 2.04: d2anpa1
  • Heterogens: ZN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2anpA (A:)
    mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
    pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
    giaavtevirvlsennfqpkrsiafmayaahevglrgsqdlanqyksegknvvsalqldm
    tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
    ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg