PDB entry 2ano

View 2ano on RCSB PDB site
Description: Crystal structure of E.coli dihydrofolate reductase in complex with NADPH and the inhibitor MS-SH08-17
Class: oxidoreductase
Keywords: DHFR, Protein inhibitor complex, OXIDOREDUCTASE
Deposited on 2005-08-11, released 2006-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.237
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Escherichia coli [TaxId:562]
  Gene: folA, tmrA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABQ4 (0-158)
    • engineered (36)
  Domains in SCOPe 2.08: d2anoa_
• Heterogens: MN, NDP, 817, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2anoA (A:)
  misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
  ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
  gdthfpdyepddwesvfsefhdadaqnshsycfeilerr