PDB entry 2anf

View 2anf on RCSB PDB site
Description: Interactions of protective signalling factor with chitin-like polysaccharide: Crystal structure of the complex between signalling protein from sheep (SPS-40) and a hexasaccharide at 2.5A resolution
Class: signaling protein
Keywords: signalling protein, complex, hexasaccharide, crystal structure
Deposited on 2005-08-11, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-10-04, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.184
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase-3 like protein 1
    Species: Ovis aries
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2anfa1, d2anfa2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2anfA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptfg
    rsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae
    v