PDB entry 2ami

View 2ami on RCSB PDB site
Description: Solution Structure Of The Calcium-loaded N-Terminal Sensor Domain Of Centrin
Class: cell cycle
Keywords: Four-Helix Bundle, Calcium Sensor, EF-Hand Calcium Binding Protein, Calmodulin, Centrin, CELL CYCLE
Deposited on 2005-08-09, released 2005-08-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caltractin
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2amia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2amiA (A:)
    gsmsykaktvvsarrdqkkgrvglteeqkqeireafdlfdtdgsgtidakelkvamralg
    fepkkeeikkmiseidkdgsgtidfeefltmmtakm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2amiA (A:)
    rvglteeqkqeireafdlfdtdgsgtidakelkvamralgfepkkeeikkmiseidkdgs
    gtidfeefltmmtakm