PDB entry 2alx

View 2alx on RCSB PDB site
Description: Ribonucleotide Reductase R2 from Escherichia coli in space group P6(1)22
Class: oxidoreductase
Keywords: ribonucleotide reductase R2, new crystal form, diiron center, dimanganese center, OXIDOREDUCTASE
Deposited on 2005-08-08, released 2005-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase 1
    Species: Escherichia coli [TaxId:562]
    Gene: nrdB, ftsB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2alxa_
  • Heterogens: MN, HG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2alxA (A:)
    mayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdr
    idyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihs
    rsythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvng
    ktvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardea
    lhltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigl
    nkdilcqyveyitnirmqavgldlpfqtrsnpipwintwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2alxA (A:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfqtrsnpipwintwl