PDB entry 2ali

View 2ali on RCSB PDB site
Description: Structure of Protein of Unknown Function PA2801 from Pseudomonas aeruginosa, Putative Thioesterase
Class: structural genomics, unknown function
Keywords: structural genomics, PA2801, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-08-05, released 2005-09-20
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.178
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA2801
    Species: Pseudomonas aeruginosa
    Gene: PA2801
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I042 (Start-155)
      • modified residue (40)
    Domains in SCOP 1.75: d2alia1
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2aliA (A:)
mgsshhhhhhssgrenlyfqghmadrqllhtahipvrwgdmdsyghvnntlyfqyleear
vawfetlgidlegaaegpvvlqslhtylkpvvhpatvvvelyagrlgtsslvlehrlhtl
edpqgtygeghcklvwvrhaenrstpvpdsiraaiags

    Sequence, based on observed residues (ATOM records): (download) 
    >2aliA (A:)
qllhtahipvrwgdmdsyghvnntlyfqyleearvawfetlgidlegaaegpvvlqslht
ylkpvvhpatvvvelyagrlgtsslvlehrlhtledpqgtygeghcklvwvrhaenrstp
vpdsiraaia