PDB entry 2ale

View 2ale on RCSB PDB site
Description: Crystal structure of yeast RNA splicing factor Snu13p
Class: RNA binding protein
Keywords: splicing, RNA, yeast, his-tag, RNA binding protein
Deposited on 2005-08-05, released 2006-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NHP2/L7aE family protein YEL026W
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39990 (0-125)
      • cloning artifact (126-127)
      • expression tag (128-131)
    Domains in SCOPe 2.08: d2alea1, d2alea2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2aleA (A:)
msapnpkafpladaaltqqildvvqqaanlrqlkkganeatktlnrgisefiimaadcep
ieillhlpllcedknvpyvfvpsrvalgracgvsrpviaasittndasaiktqiyavkdk
ietllilehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2aleA (A:)
msapnpkafpladaaltqqildvvqqaanlrqlkkganeatktlnrgisefiimaadcep
ieillhlpllcedknvpyvfvpsrvalgracgvsrpviaasittndasaiktqiyavkdk
ietllilehhhh