PDB entry 2ala

View 2ala on RCSB PDB site
Description: Crystal structure of the Semliki Forest Virus envelope protein E1 in its monomeric conformation.
Class: viral protein
Keywords: Envelope glycoprotein, Membrane Fusion, Viral protein
Deposited on 2005-08-05, released 2006-01-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.272
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Structural polyprotein (P130)
    Species: Semliki forest virus [TaxId:11033]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2alaa1, d2alaa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2alaA (A:)
    yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
    kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
    aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
    kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
    kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftriveaptiidlt
    ctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkvtlhfstas
    aspsfvvslcsaratcsasceppkdhivpya
    

    Sequence, based on observed residues (ATOM records): (download)
    >2alaA (A:)
    yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
    kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
    aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
    kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
    kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftriveaptiidlt
    ctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkvtlhfstas
    aspsfvvslcsaratcsasceppk