PDB entry 2al3

View 2al3 on RCSB PDB site
Description: Solution structure and backbone dynamics of an N-terminal ubiquitin-like domain in the GLUT4-tethering protein, TUG
Class: endocytosis/exocytosis
Keywords: TUG UBL1 Insulin
Deposited on 2005-08-04, released 2006-03-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-21, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TUG long isoform
    Species: MUS MUSCULUS
    Gene: tug
    Database cross-references and differences (RAF-indexed):
    • GB AAR01614
    Domains in SCOP 1.73: d2al3a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2al3A (A:)
maapaggggsavsvlapngrrhtvkvtpstvllqvledtcrrqdfnpseydlkfqrtvld
lslqwrfanlpnnaklemvpvsrsregpen

    Sequence, based on observed residues (ATOM records): (download) 
    >2al3A (A:)
savsvlapngrrhtvkvtpstvllqvledtcrrqdfnpseydlkfqrtvldlslqwrfan
lpnnaklemvpvsrsr