PDB entry 2aka

View 2aka on RCSB PDB site
Description: Structure of the nucleotide-free myosin II motor domain from Dictyostelium discoideum fused to the GTPase domain of dynamin 1 from Rattus norvegicus
Class: contractile protein
Keywords: fusion protein, GTPase domain, dynamin, myosin, CONTRACTILE PROTEIN
Deposited on 2005-08-03, released 2005-08-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin II heavy chain
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: MHCA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Dynamin-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Dnm1, Dnm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2akab1
  • Chain 'L':
    Compound: linker
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2AKA (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2akaB (B:)
    medliplvnrlqdafsaigqnadldlpqiavvggqsagkssvlenfvgrdflprgsgivt
    rrplvlqlvnstteyaeflhckgkkftdfeevrleieaetdrvtgtnkgispvpinlrvy
    sphvlnltlvdlpgmtkvpvgdqppdiefqirdmlmqfvtkenclilavspansdlansd
    alkiakevdpqgqrtigvitkldlmdegtdardvlenkllplrrgyigvvnrsqkdidgk
    kditaalaaerkfflshpsyrhladrmgtpylqkvlnqqltnhirdtlpglrnklqsql
    

  • Chain 'L':
    No sequence available.