PDB entry 2ajy

View 2ajy on RCSB PDB site
Description: Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with ecgonine methyl ester and benzoic acid
Class: immune system
Keywords: catalytic Antibody, Fab, ecgonine methyl ester, benzoic acid, HYDROLYTIC, IMMUNE SYSTEM
Deposited on 2005-08-02, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: Antibody 7A1 Fab'
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 2AJY (0-218)
• Chain 'L':
  Compound: Antibody 7A1 Fab'
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 2AJY (0-215)
  Domains in SCOPe 2.07: d2ajyl1, d2ajyl2
• Heterogens: ZN, ECG, BEZ, HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ajyL (L:)
  divitqdelsnpvtsgesvsiscrssrsllykdgrtylnwflqrpgqspqlliylmstra
  sgvsdrfsgsgsgtdftleisrvkaedvgvyycqqfveypftfgsgtkleikradaaptv
  sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
  sstltltkdeyerhnsytceathktstspivksfnr