PDB entry 2ajs

View 2ajs on RCSB PDB site
Description: Crystal structure of cocaine catalytic antibody 7A1 Fab' in complex with heptaethylene glycol
Class: immune system
Keywords: CATALYTIC Antibody, Fab, COCAINE, HYDROLYTIC, Heptaethylene glycol, IMMUNE SYSTEM
Deposited on 2005-08-02, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Antibody 7A1 Fab'
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AJS (0-218)
  • Chain 'L':
    Compound: Antibody 7A1 Fab'
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AJS (0-215)
    Domains in SCOPe 2.07: d2ajsl1, d2ajsl2
  • Heterogens: GOL, SO4, P33, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ajsL (L:)
    divitqdelsnpvtsgesvsiscrssrsllykdgrtylnwflqrpgqspqlliylmstra
    sgvsdrfsgsgsgtdftleisrvkaedvgvyycqqfveypftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr