PDB entry 2aiq

View 2aiq on RCSB PDB site
Description: Crystal structure of benzamidine-inhibited protein C activator from the venom of copperhead snake Agkistrodon contortrix contortrix
Class: hydrolase
Keywords: Protein C activator, snake venom serine proteinase, hydrolase
Deposited on 2005-07-30, released 2005-09-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.169
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein C activator
  Species: Agkistrodon contortrix contortrix [TaxId:8713]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09872 (0-223)
  Domains in SCOPe 2.03: d2aiqa_
• Heterogens: NAG, NDG, SO4, ACT, CL, BEN, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aiqA (A:)
  viggdecninehrflalvyangslcggtlinqewvltarhcdrgnmriylgmhnlkvlnk
  dalrrfpkekyfclntrndtiwdkdimlirlnrpvrnsahiaplslpsnppsvgsvcrim
  gwgtitspnatlpdvphcaninildyavcqaaykglaattlcagileggkdtckgdsggp
  licngqfqgilsvggnpcaqprkpgiytkvfdytdwiqsiisgntdatcpp