PDB entry 2aig

View 2aig on RCSB PDB site
Description: adamalysin II with peptidomimetic inhibitor pol647
Class: hydrolast/hydrolase inhibitor
Keywords: zinc protease, metalloendopetidase, complex of metalloprotease-inhibitor, hydrolast-hydrolase inhibitor complex
Deposited on 1997-10-12, released 1998-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: adamalysin II
    Species: Crotalus adamanteus [TaxId:8729]
    Database cross-references and differences (RAF-indexed):
    • GB AAB31038 (1-201)
    Domains in SCOPe 2.08: d2aigp_
  • Heterogens: 0GR, ZN, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2aigP (P:)
    xnlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiws
    gqdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnpr
    ssvgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsd
    dsmgyyqkflnqykpqcilnkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aigP (P:)
    nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg
    qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs
    svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
    smgyyqkflnqykpqcilnkp