PDB entry 2aif

View 2aif on RCSB PDB site
Description: Crystal Structure of High Mobility Like Protein, NHP2, putative from Cryptosporidium parvum
Class: DNA binding protein, cytokine
Keywords: ribosomal protein, High-mobility like protein, Transcription factor, Structural Genomics, Structural Genomics Consortium, SGC, DNA BINDING PROTEIN, CYTOKINE
Deposited on 2005-07-29, released 2005-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein L7A
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aifa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aifA (A:)
    gssqneasedtgfnpkafplaspdlnnkiinlvqqacnykqlrkganeatkalnrgiaei
    vllaadaepleillhlplvcedkntpyvfvrskvalgracgvsrpviaaaitskdgssls
    sqitelkdqieqilv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aifA (A:)
    fplaspdlnnkiinlvqqacnykqlrkganeatkalnrgiaeivllaadaepleillhlp
    lvcedkntpyvfvrskvalgracgvsrpviaaaitskdgsslssqitelkdqieq