PDB entry 2ai5

View 2ai5 on RCSB PDB site
Description: Solution Structure of Cytochrome C552, determined by Distributed Computing Implementation for NMR data
Class: electron transport
Keywords: cytochrome C, electron transport, porphyrin, ferrous iron
Deposited on 2005-07-29, released 2006-05-23
The last revision prior to the SCOP 1.75 freeze date was dated 2006-05-23, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c-552
    Species: Hydrogenobacter thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ai5a1
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ai5A (A:)
    neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
    pqnvtdaeakqlaqwilsik