PDB entry 2ai0

View 2ai0 on RCSB PDB site
Description: Anti-Cocaine Antibody 7.5.21, Crystal Form III
Class: immune system
Keywords: Immune System
Deposited on 2005-07-28, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ai0h1
  • Chain 'I':
    Compound: immunoglobulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ai0i1
  • Chain 'J':
    Compound: immunoglobulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ai0j1
  • Chain 'K':
    Compound: immunoglobulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ai0k1
  • Chain 'L':
    Compound: immunoglobulin light chain kappa
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AI0 (0-216)
    Domains in SCOPe 2.07: d2ai0l1, d2ai0l2
  • Chain 'M':
    Compound: immunoglobulin light chain kappa
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AI0 (0-216)
    Domains in SCOPe 2.07: d2ai0m1, d2ai0m2
  • Chain 'N':
    Compound: immunoglobulin light chain kappa
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AI0 (0-End)
    Domains in SCOPe 2.07: d2ai0n1, d2ai0n2
  • Chain 'O':
    Compound: immunoglobulin light chain kappa
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AI0 (0-216)
    Domains in SCOPe 2.07: d2ai0o1, d2ai0o2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ai0H (H:)
    dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhddyygkspyffdvwgagttvt
    assakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ai0H (H:)
    dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhdffdvwgagttvtassakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ai0I (I:)
    dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhddyygkspyffdvwgagttvt
    assakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ai0I (I:)
    dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhddyygkspyffdvwgagttvt
    assakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2ai0J (J:)
    dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhddyygkspyffdvwgagttvt
    assakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ai0J (J:)
    dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhddyygkspyffdvwgagttvt
    assakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2ai0K (K:)
    dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhddyygkspyffdvwgagttvt
    assakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ai0K (K:)
    dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhdspyffdvwgagttvtassak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ai0L (L:)
    dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgrspklliykvsnrf
    sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2ai0M (M:)
    dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgrspklliykvsnrf
    sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ai0M (M:)
    dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgrspklliykvsnrf
    sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathtspivksfnrn
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2ai0N (N:)
    dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgrspklliykvsnrf
    sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ai0N (N:)
    dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgrspklliykvsnrf
    sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ai0O (O:)
    dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgrspklliykvsnrf
    sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn