PDB entry 2ah6

View 2ah6 on RCSB PDB site
Description: Crystal structure of a putative cobalamin adenosyltransferase (bh1595) from bacillus halodurans c-125 at 1.60 A resolution
Class: transferase
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, transferase
Deposited on 2005-07-27, released 2005-08-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.15
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BH1595, unknown conserved protein
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: 10174212
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KCH6
      • see remark 999 (53)
      • modified residue (86)
    Domains in SCOPe 2.05: d2ah6a_
  • Chain 'B':
    Compound: BH1595, unknown conserved protein
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: 10174212
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KCH6
      • see remark 999 (53)
      • modified residue (86)
    Domains in SCOPe 2.05: d2ah6b_
  • Chain 'C':
    Compound: BH1595, unknown conserved protein
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: 10174212
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KCH6
      • see remark 999 (53)
      • modified residue (86)
    Domains in SCOPe 2.05: d2ah6c_
  • Heterogens: NO3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ah6A (A:)
    mgsdkihhhhhhmrlytrtgdkgktsviggrlakddtrvvaygttdelnsfvgsaitqld
    entfadirgelfkiqhelfdcggdlamlkvkedrpykakqeivdfleqridayikeapel
    erfilpggseaaaslhvcrtiarraeryvvrlqqegeinpivlkylnrlsdyffavarvv
    nsrlqvpdveyersaivfregkrkedkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ah6A (A:)
    dtrvvaygttdelnsfvgsaitqldentfadirgelfkiqhelfdcggdlamlpykakqe
    ivdfleqridayikeapelerfilpggseaaaslhvcrtiarraeryvvrlqqegeinpi
    vlkylnrlsdyffavarvvnsrlqvpdveye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ah6B (B:)
    mgsdkihhhhhhmrlytrtgdkgktsviggrlakddtrvvaygttdelnsfvgsaitqld
    entfadirgelfkiqhelfdcggdlamlkvkedrpykakqeivdfleqridayikeapel
    erfilpggseaaaslhvcrtiarraeryvvrlqqegeinpivlkylnrlsdyffavarvv
    nsrlqvpdveyersaivfregkrkedkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ah6B (B:)
    rlakddtrvvaygttdelnsfvgsaitqldentfadirgelfkiqhelfdcggdlamlkv
    kedrpykakqeivdfleqridayikeapelerfilpggseaaaslhvcrtiarraeryvv
    rlqqegeinpivlkylnrlsdyffavarvvnsrlqvpdveye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ah6C (C:)
    mgsdkihhhhhhmrlytrtgdkgktsviggrlakddtrvvaygttdelnsfvgsaitqld
    entfadirgelfkiqhelfdcggdlamlkvkedrpykakqeivdfleqridayikeapel
    erfilpggseaaaslhvcrtiarraeryvvrlqqegeinpivlkylnrlsdyffavarvv
    nsrlqvpdveyersaivfregkrkedkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ah6C (C:)
    ddtrvvaygttdelnsfvgsaitqldentfadirgelfkiqhelfdcggdlamlkvkedr
    pykakqeivdfleqridayikeapelerfilpggseaaaslhvcrtiarraeryvvrlqq
    egeinpivlkylnrlsdyffavarvvnsrlqvpdveyersai