PDB entry 2ah2

View 2ah2 on RCSB PDB site
Description: Trypanosoma cruzi trans-sialidase in complex with 2,3-difluorosialic acid (covalent intermediate)
Class: hydrolase
Keywords: transglycosidase, covalent intermediate, trypanosoma cruzi, sialic acid
Deposited on 2005-07-27, released 2005-08-23
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-23, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.099
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trans-sialidase
    Species: Trypanosoma cruzi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26966 (14-End)
      • engineered (71)
      • see remark 999 (275)
      • see remark 999 (489)
      • see remark 999 (497)
      • engineered (508-509)
      • engineered (533)
      • see remark 999 (571)
      • engineered (606)
      • engineered (610)
      • engineered (612)
    Domains in SCOP 1.73: d2ah2a1, d2ah2a2
  • Heterogens: CL, FSI, GOL, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ah2A (A:)
    mggshhhhhhgmaslapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvm
    vaiadaryetsfdnslidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnkl
    yvlvgsynssrsywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpae
    megmhtnqflggagvaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsaf
    gcsepvalewegkliintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsq
    ssftavtiegmrvmlfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvl
    ykddklyclheinsnevyslvfarlvgelriiksvlqswknwdshlssictpadpaasss
    ergcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpv
    sqqgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqp
    iygstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyv
    ggykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ah2A (A:)
    lapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdn
    slidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsyw
    tshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggag
    vaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkl
    iintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvm
    lfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheins
    nevyslvfarlvgelriiksvlqswknwdshlssictpagcgpavttvglvgflshsatk
    tewedayrcvnastanaervpnglkfagvgggalwpvsqqgqnqryhfanhaftlvasvt
    ihevpkgaspllgasldssggkkllglsydkrhqwqpiygstpvtptgswemgkryhvvl
    tmankigsvyidgeplegsgqtvvpdertpdishfyvggykrsgmptdsrvtvnnvllyn
    rqlnaeeirtlflsqdligteahm