PDB entry 2ags

View 2ags on RCSB PDB site
Description: Trypanosoma rangeli Sialidase in Complex with 2-Keto-3-deoxy-D-glycero-D-galacto-2,3-difluoro-nononic acid (2,3-difluoro-KDN)
Class: hydrolase
Keywords: beta-propeller, covalent enzyme-intermediate complex, beta-sandwich
Deposited on 2005-07-27, released 2005-11-22
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-28, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.154
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: Trypanosoma rangeli
    Database cross-references and differences (RAF-indexed):
    • Uniprot O44049 (14-End)
      • cloning artifact (11-13)
      • see remark 999 (63)
      • see remark 999 (199)
      • see remark 999 (385)
      • see remark 999 (619)
    Domains in SCOP 1.73: d2agsa1, d2agsa2
  • Heterogens: SO4, FKD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2agsA (A:)
    mggshhhhhhgmaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgv
    mvaiadaryetsfdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnk
    lyilvgsfnktrnswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpa
    efdgiltkefiggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrsk
    fgcsepavlewegkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdc
    qssfvavtiegkrvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssv
    lykddklyslheintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpatpp
    skggcgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwp
    varqgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwr
    plygaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfy
    iggprskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtdggagtaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2agsA (A:)
    maslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryet
    sfdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnkt
    rnswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefi
    ggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlew
    egkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtieg
    krvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslh
    eintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpatppskggcgaavpt
    aglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryq
    fanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapaspt
    gswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggprskgapt
    dsrvtvtnvvlynrrlnsseirtlflsqdmigtd