PDB entry 2agh

View 2agh on RCSB PDB site
Description: Structural basis for cooperative transcription factor binding to the CBP coactivator
Class: transcription
Keywords: Transcription
Deposited on 2005-07-26, released 2005-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myb proto-oncogene protein
    Species: Mus musculus [TaxId:10090]
    Gene: Myb
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Crebbp protein
    Species: Mus musculus [TaxId:10090]
    Gene: CBP, CREBBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aghb_
  • Chain 'C':
    Compound: Zinc finger protein HRX
    Species: Homo sapiens [TaxId:9606]
    Gene: MLL, ALL1, HRX, HTRX, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03164 (0-30)
      • conflict (2)

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2aghB (B:)
gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
rdeyyhllaekiykiqkeleekrrsrl

  • Chain 'C':
    No sequence available.