PDB entry 2afn

View 2afn on RCSB PDB site
Description: structure of alcaligenes faecalis nitrite reductase and a copper site mutant, m150e, that contains zinc
Class: oxidoreductase (nitric oxide(a))
Keywords: oxidoreductase, (nitric oxide (a)), copper, flavoprotein, fad, nitrite assimilation, oxidoreductase (nitric oxide(a))
Deposited on 1995-07-03, released 1996-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.158
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2afna1, d2afna2
  • Chain 'B':
    Compound: nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2afnb1, d2afnb2
  • Chain 'C':
    Compound: nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2afnc1, d2afnc2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2afnA (A:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afnA (A:)
    iaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtv
    pgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatk
    pgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdfyvprd
    engkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvlivhsqa
    nrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayvnhnl
    ieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2afnB (B:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afnB (B:)
    iaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtv
    pgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatk
    pgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdfyvprd
    engkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvlivhsqa
    nrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayvnhnl
    ieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2afnC (C:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2afnC (C:)
    iaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtv
    pgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatk
    pgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdfyvprd
    engkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvlivhsqa
    nrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayvnhnl
    ieafelgaaahfkvtgewnddlmtsvlapsg