PDB entry 2af7

View 2af7 on RCSB PDB site
Description: Crystal structure of the gamma-carboxymuconolactone decarboxylase from Methanobacterium thermoautotrophicum. Northeast Structural Genomics Consortium target TT747.
Class: lyase
Keywords: Gamma-carboxymuconolactone decarboxylase, O26336_METTH, NESG, TT747, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, LYASE
Deposited on 2005-07-25, released 2005-08-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.245
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma-carboxymuconolactone decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MTH234
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26336 (0-End)
      • modified residue (0)
      • modified residue (7)
      • modified residue (13)
      • modified residue (93)
      • modified residue (96)
    Domains in SCOPe 2.01: d2af7a1
  • Chain 'B':
    Compound: gamma-carboxymuconolactone decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MTH234
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26336
      • modified residue (7)
      • modified residue (13)
      • modified residue (93)
      • modified residue (96)
    Domains in SCOPe 2.01: d2af7b_
  • Chain 'C':
    Compound: gamma-carboxymuconolactone decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MTH234
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26336
      • modified residue (7)
      • modified residue (13)
      • modified residue (93)
      • modified residue (96)
    Domains in SCOPe 2.01: d2af7c_
  • Chain 'D':
    Compound: gamma-carboxymuconolactone decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MTH234
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26336 (0-End)
      • modified residue (0)
      • modified residue (7)
      • modified residue (13)
      • modified residue (93)
      • modified residue (96)
    Domains in SCOPe 2.01: d2af7d_
  • Chain 'E':
    Compound: gamma-carboxymuconolactone decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MTH234
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26336 (0-End)
      • modified residue (0)
      • modified residue (7)
      • modified residue (13)
      • modified residue (93)
      • modified residue (96)
    Domains in SCOPe 2.01: d2af7e_
  • Chain 'F':
    Compound: gamma-carboxymuconolactone decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MTH234
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26336
      • modified residue (7)
      • modified residue (13)
      • modified residue (93)
      • modified residue (96)
    Domains in SCOPe 2.01: d2af7f_
  • Chain 'G':
    Compound: gamma-carboxymuconolactone decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MTH234
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26336
      • modified residue (7)
      • modified residue (13)
      • modified residue (93)
      • modified residue (96)
    Domains in SCOPe 2.01: d2af7g_
  • Chain 'H':
    Compound: gamma-carboxymuconolactone decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MTH234
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26336
      • modified residue (7)
      • modified residue (13)
      • modified residue (93)
      • modified residue (96)
    Domains in SCOPe 2.01: d2af7h_
  • Chain 'I':
    Compound: gamma-carboxymuconolactone decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MTH234
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26336
      • modified residue (7)
      • modified residue (13)
      • modified residue (93)
      • modified residue (96)
    Domains in SCOPe 2.01: d2af7i_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2af7A (A:)
    meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
    laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevften
    dpaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2af7A (A:)
    meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
    laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevfte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2af7B (B:)
    meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
    laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevften
    dpaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2af7B (B:)
    eryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrelltl
    aaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevfte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2af7C (C:)
    meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
    laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevften
    dpaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2af7C (C:)
    eryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrelltl
    aaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevfte
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2af7D (D:)
    meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
    laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevften
    dpaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2af7D (D:)
    meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
    laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevften
    dp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2af7E (E:)
    meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
    laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevften
    dpaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2af7E (E:)
    meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
    laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevften
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2af7F (F:)
    meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
    laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevften
    dpaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2af7F (F:)
    eryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrelltl
    aaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevftend
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2af7G (G:)
    meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
    laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevften
    dpaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2af7G (G:)
    eryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrelltl
    aaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevfte
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2af7H (H:)
    meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
    laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevften
    dpaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2af7H (H:)
    eryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrelltl
    aaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevften
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2af7I (I:)
    meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrellt
    laaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevften
    dpaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2af7I (I:)
    eryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrelltl
    aaltvlraddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevftend