PDB entry 2aeb

View 2aeb on RCSB PDB site
Description: Crystal structure of human arginase I at 1.29 A resolution and exploration of inhibition in immune response.
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE, BINUCLEAR MANGANESE CLUSTER, BORONIC ACID INHIBITOR, PERFECTLY TWINNED CRYSTAL, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2005-07-21, released 2005-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: 0.165
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aeba_
  • Chain 'B':
    Compound: arginase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aebb_
  • Heterogens: MN, ABH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aebA (A:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aebA (A:)
    srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
    qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
    ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
    gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
    gtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
    glaregnhkpidyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aebB (B:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aebB (B:)
    srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
    qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
    ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
    gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
    gtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
    glaregnhk