PDB entry 2adx

View 2adx on RCSB PDB site
Description: fifth egf-like domain of thrombomodulin (tmegf5), nmr, minimized average structure
Class: blood coagulation
Keywords: blood coagulation, anticoagulant, fibrinogen, nmr, peptide synthesis, protein c, thrombin, disulfide bonds
Deposited on 1997-02-18, released 1997-12-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thrombomodulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2adxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2adxA (A:)
    qmfcnqtacpadcdpntqascecpegyilddgfictdide