PDB entry 2adi

View 2adi on RCSB PDB site
Description: Crystal structure of monoclonal anti-CD4 antibody Q425 in complex with Barium
Class: immune system
Keywords: anti-CD4, interfacial metal, antibody recognition, IMMUNE SYSTEM
Deposited on 2005-07-20, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Q425 Fab Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ADI (0-End)
    Domains in SCOPe 2.07: d2adia1, d2adia2
  • Chain 'B':
    Compound: Q425 Fab Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ADI (0-End)
    Domains in SCOPe 2.07: d2adib1
  • Heterogens: BA, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2adiA (A:)
    ettvtqspaslsvaigekvtircitstdidddmnwyqqkpgeppkffisegntlrpgvps
    rfsssgygtdfvftienmlsedvadyyclqsdtlpltfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2adiA (A:)
    ettvtqspaslsvaigekvtircitstdidddmnwyqqkpgeppkffisegntlrpgvps
    rfsssgygtdfvftienmlsedvadyyclqsdtlpltfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2adiB (B:)
    evqlvesggdlvkpggslklscaasgftfssygmswvrqtpdkglewvatissggsytyy
    pdnvkgrftisrdnakntlylqmsslksedtamyycarhedgnwnyfdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2adiB (B:)
    evqlvesggdlvkpggslklscaasgftfssygmswvrqtpdkglewvatissggsytyy
    pdnvkgrftisrdnakntlylqmsslksedtamyycarhedgnwnyfdywgqgttltvss
    akttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivpr