PDB entry 2acg

View 2acg on RCSB PDB site
Description: acanthamoeba castellanii profilin ii
Deposited on 1994-08-30, released 1994-11-01
The last revision prior to the SCOP 1.69 freeze date was dated 2001-02-15, with a file datestamp of 2001-02-15.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d2acg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2acg_ (-)
swqtyvdtnlvgtgavtqaaiighdgntwatsagfavspangaalanafkdatairsngf
elagtryvtiraddrsvygkkgsagvitvktskailigvynekiqpgtaanvvekladyl
igqgf