PDB entry 2aca

View 2aca on RCSB PDB site
Description: X-ray structure of a putative adenylate cyclase Q87NV8 from Vibrio parahaemolyticus at the 2.25 A resolution. Northeast Structural Genomics Target VpR19.
Class: structural genomics, unknown function
Keywords: NESG, VPR19, Q87NV8, adenylate cyclase, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2005-07-18, released 2005-08-02
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.227
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative adenylate cyclase
    Species: Vibrio parahaemolyticus
    Gene: VP1760
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87NV8 (Start-180)
      • modified residue (27)
      • modified residue (36)
      • modified residue (98)
      • modified residue (102)
      • modified residue (141)
    Domains in SCOP 1.73: d2acaa1
  • Chain 'B':
    Compound: putative adenylate cyclase
    Species: Vibrio parahaemolyticus
    Gene: VP1760
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87NV8 (Start-180)
      • modified residue (27)
      • modified residue (36)
      • modified residue (98)
      • modified residue (102)
      • modified residue (141)
    Domains in SCOP 1.73: d2acab1
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2acaA (A:)
    mvsdahfqgqfevelkyrvknhdaflnmvkqiehevmfennqesdwfydtpqrtltqqgk
    slvlreiqpagiklwivkgpeadrceatnitkldsaqsmlenmgyeviqcskkirsiffv
    gefhitldfldgfghfaefaimtddetalaryrerlvalaqqfhlseadrehrsykeils
    alehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2acaA (A:)
    qgqfevelkyrvknhdaflnmvkqiehevmfennqesdwfydtpqrtltqqgkslvlrei
    qpagiklwivkgpeadrceatnitkldsaqsmlenmgyeviqcskkirsiffvgefhitl
    dfldgfghfaefaimtddetalaryrerlvalaqqfhlseadrehrsykeilsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2acaB (B:)
    mvsdahfqgqfevelkyrvknhdaflnmvkqiehevmfennqesdwfydtpqrtltqqgk
    slvlreiqpagiklwivkgpeadrceatnitkldsaqsmlenmgyeviqcskkirsiffv
    gefhitldfldgfghfaefaimtddetalaryrerlvalaqqfhlseadrehrsykeils
    alehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2acaB (B:)
    qgqfevelkyrvknhdaflnmvkqiehevmfennqesdwfydtpqrtltqqgkslvlrei
    qpagiklwivkgpeadrceatnitkldsaqsmlenmgyeviqcskkirsiffvgefhitl
    dfldgfghfaefaimtddetalaryrerlvalaqqfhlseadrehrsykeilsa