PDB entry 2abi

View 2abi on RCSB PDB site
Description: Crystal structure of the human mineralocorticoid receptor ligand-binding domain bound to deoxycorticosterone
Class: transcription regulator
Keywords: mineralocorticoid receptor, steroid recepto, nuclear recept, transcription regulation, activating mutation, hypertension, transcription regulator
Deposited on 2005-07-15, released 2006-07-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.207
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2abia_
  • Chain 'B':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2abib_
  • Chain 'C':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2abic_
  • Heterogens: 1CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2abiA (A:)
    gssraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlp
    gfknlpledqitliqyswmclssfalswrsykhtnsqflyfapdlvfneekmhqsamyel
    cqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvt
    kapnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdql
    pkvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abiA (A:)
    spvmvleniepeivyagtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqitliq
    yswmclssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfvrlq
    ltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtwqrfyqltklldsmh
    dlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2abiB (B:)
    gssraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlp
    gfknlpledqitliqyswmclssfalswrsykhtnsqflyfapdlvfneekmhqsamyel
    cqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvt
    kapnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdql
    pkvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abiB (B:)
    spvmvleniepeivyagyddtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqit
    liqyswmclssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfv
    rlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtswqrfyqltkll
    dsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2abiC (C:)
    gssraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlp
    gfknlpledqitliqyswmclssfalswrsykhtnsqflyfapdlvfneekmhqsamyel
    cqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvt
    kapnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdql
    pkvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abiC (C:)
    spvmvleniepeivyagyddtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqit
    liqyswmclssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfv
    rlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtswqrfyqltkll
    dsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfh