PDB entry 2abb

View 2abb on RCSB PDB site
Description: Structure of PETN reductase Y186F in complex with cyanide
Class: oxidoreductase
Keywords: PETN reductase, proton transfer, flavoenzyme, OXIDOREDUCTASE
Deposited on 2005-07-15, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.139
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71278 (Start-363)
      • engineered (185)
    Domains in SCOPe 2.07: d2abba1
  • Heterogens: SCN, FMN, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2abbA (A:)
    saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
    isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
    sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
    hsahgfllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
    qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
    gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
    ypsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abbA (A:)
    klftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqisa
    qakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsas
    alnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhsa
    hgfllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqnv
    dngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigagay
    taekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyps
    l