PDB entry 2aba

View 2aba on RCSB PDB site
Description: Structure of reduced PETN reductase in complex with progesterone
Class: oxidoreductase
Keywords: Reduced flavoprotein, atomic resolution, progesterone, PETN, OXIDOREDUCTASE
Deposited on 2005-07-15, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.129
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2abaa_
  • Heterogens: FMN, STR, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2abaA (A:)
    saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
    isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
    sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
    hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
    qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
    gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
    ypsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2abaA (A:)
    eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
    aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
    salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
    ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
    vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
    ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
    sl