PDB entry 2ab2

View 2ab2 on RCSB PDB site
Description: Mineralocorticoid Receptor Double Mutant with Bound Spironolactone
Class: transcription
Keywords: Mineralocorticoid receptor, MR, Nuclear Receptor, Steroid Receptor, Spironolactone, Hypertension, TRANSCRIPTION
Deposited on 2005-07-14, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.197
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered (98)
      • engineered (100)
    Domains in SCOPe 2.06: d2ab2a_
  • Chain 'B':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered (98)
      • engineered (100)
    Domains in SCOPe 2.06: d2ab2b_
  • Heterogens: SO4, SNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ab2A (A:)
    gsapakepsvntalvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstl
    nrlagkqmiqvvkwakvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyf
    apdlvfneekmhqsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksq
    aafeemrtnyikelrkmvtkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfres
    halkvefpamlveiisdqlpkvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ab2A (A:)
    lvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvk
    wakvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhq
    samyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyike
    lrkmvtkcnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlvei
    isdqlpkvesgnakplyfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ab2B (B:)
    gsapakepsvntalvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstl
    nrlagkqmiqvvkwakvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyf
    apdlvfneekmhqsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksq
    aafeemrtnyikelrkmvtkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfres
    halkvefpamlveiisdqlpkvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ab2B (B:)
    lvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvk
    wakvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhq
    samyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyike
    lrkmvtcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlvei
    isdqlpkvesgnakplyfh