PDB entry 2aa7

View 2aa7 on RCSB PDB site
Description: Mineralocorticoid Receptor with Bound Deoxycorticosterone
Class: transcription
Keywords: Mineralocorticoid receptor, MR, Nuclear Receptor, Steroid Receptor, Deoxycorticosterone, Hypertension, TRANSCRIPTION
Deposited on 2005-07-13, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered (98)
    Domains in SCOPe 2.06: d2aa7a_
  • Heterogens: SO4, 1CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aa7A (A:)
    gsapakepsvntalvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstl
    nrlagkqmiqvvkwakvlpgfknlpledqitliqyswmslssfalswrsykhtnsqflyf
    apdlvfneekmhqsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksq
    aafeemrtnyikelrkmvtkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfres
    halkvefpamlveiisdqlpkvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aa7A (A:)
    lstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakv
    lpgfknlpledqitliqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamy
    elcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkm
    vtksgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpk
    vesgnakplyfhr