PDB entry 2aa5

View 2aa5 on RCSB PDB site
Description: Mineralocorticoid Receptor with Bound Progesterone
Class: transcription
Keywords: Mineralocorticoid receptor, MR, Nuclear Receptor, Steroid Receptor, Progesterone, TRANSCRIPTION
Deposited on 2005-07-13, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.22
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered (98)
    Domains in SCOPe 2.06: d2aa5a_
  • Chain 'B':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered (98)
    Domains in SCOPe 2.06: d2aa5b_
  • Heterogens: STR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aa5A (A:)
    gsapakepsvntalvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstl
    nrlagkqmiqvvkwakvlpgfknlpledqitliqyswmslssfalswrsykhtnsqflyf
    apdlvfneekmhqsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksq
    aafeemrtnyikelrkmvtkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfres
    halkvefpamlveiisdqlpkvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aa5A (A:)
    alvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvv
    kwakvlpgfknlpledqitliqyswmslssfalswrsykhtnsqflyfapdlvfneekmh
    qsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyik
    elrkmvtkcswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdq
    lpkvesgnakplyfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aa5B (B:)
    gsapakepsvntalvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstl
    nrlagkqmiqvvkwakvlpgfknlpledqitliqyswmslssfalswrsykhtnsqflyf
    apdlvfneekmhqsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksq
    aafeemrtnyikelrkmvtkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfres
    halkvefpamlveiisdqlpkvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aa5B (B:)
    lvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvk
    wakvlpgfknlpledqitliqyswmslssfalswrsykhtnsqflyfapdlvfneekmhq
    samyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyike
    lrkmvnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdq
    lpkvesgnakplyfh