PDB entry 2aa3

View 2aa3 on RCSB PDB site
Description: Crystal structure of Plasmodium vivax lactate dehydrogenase complex with APADH
Class: oxidoreductase
Keywords: Rossmann fold, OXIDOREDUCTASE
Deposited on 2005-07-13, released 2006-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • GB AAY59419 (0-314)
      • expression tag (315)
    Domains in SCOPe 2.06: d2aa3a1, d2aa3a2, d2aa3a3
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • GB AAY59419 (0-314)
    Domains in SCOPe 2.06: d2aa3b1, d2aa3b2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • GB AAY59419 (0-314)
      • expression tag (315-317)
    Domains in SCOPe 2.06: d2aa3c1, d2aa3c2, d2aa3c3
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • GB AAY59419 (0-314)
    Domains in SCOPe 2.06: d2aa3d1, d2aa3d2
  • Heterogens: SO4, AP0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aa3A (A:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkalihhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aa3A (A:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkalih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aa3B (B:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkalihhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aa3B (B:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkali
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aa3C (C:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkalihhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aa3C (C:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkalihhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2aa3D (D:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkalihhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aa3D (D:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkali