PDB entry 2a94

View 2a94 on RCSB PDB site
Description: Structure of Plasmodium falciparum lactate dehydrogenase complexed to APADH.
Class: oxidoreductase
Keywords: Rossmann fold, OXIDOREDUCTASE
Deposited on 2005-07-11, released 2006-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.16
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2a94a1, d2a94a2
  • Heterogens: AP0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a94A (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
    iivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivga
    hgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaa
    aiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekak
    fdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a94A (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
    iivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivga
    hgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaa
    aiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekak
    fdeaiaetkrmkala