PDB entry 2a8v

View 2a8v on RCSB PDB site
Description: rho transcription termination factor/rna complex
Deposited on 1998-11-08, released 1999-04-26
The last revision prior to the SCOP 1.57 freeze date was dated 1999-04-26, with a file datestamp of 1999-04-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.245
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d2a8va_
  • Chain 'B':
    Domains in SCOP 1.57: d2a8vb_
  • Chain 'C':
    Domains in SCOP 1.57: d2a8vc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a8vA (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a8vB (B:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a8vC (C:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne