PDB entry 2a78

View 2a78 on RCSB PDB site
Description: Crystal structure of the C3bot-RalA complex reveals a novel type of action of a bacterial exoenzyme
Class: protein binding/transferase
Keywords: exoenzyme C3, Bacterial ADP-ribosyltransferase, Ral, Rho, GDP-binding, PROTEIN BINDING-TRANSFERASE COMPLEX
Deposited on 2005-07-05, released 2005-10-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Ral-A
    Species: Homo sapiens [TaxId:9606]
    Gene: RALA, RAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2a78a_
  • Chain 'B':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum D phage [TaxId:29342]
    Gene: C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2a78b_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a78A (A:)
    gspgisgggggsqnslalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvv
    ldgeevqidildtagqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvke
    denvpfllvgnksdledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreir
    arkmeds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a78A (A:)
    alhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildtagq
    edyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdle
    dkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmed
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a78B (B:)
    gspgisgggggsaysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseing
    klrqnkgvingfpsnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsng
    tinktafekakakflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisa
    fagqlemllprhstyhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a78B (B:)
    tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
    ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
    kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhstyh
    iddmrlssdgkqiiitatmmgtainpk